SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011529 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011529
Domain Number 1 Region: 14-203
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.33e-55
Family Eukaryotic proteases 0.0000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011529   Gene: ENSPPYG00000010298   Transcript: ENSPPYT00000011972
Sequence length 204
Comment pep:known_by_projection chromosome:PPYG2:19:52406670:52413834:-1 gene:ENSPPYG00000010298 transcript:ENSPPYT00000011972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLTLSFLLASAAAQDGDKLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAH
CQSRFMRVRLGEHNLRKRDGPEQLRTASRVIPHPRYEARSHRHDIMLLRLVQPARLTPQV
RPAVLPTRCPHPGEACVVSGWGLVSHNEPGTTGSPQSQVSLPDTLHCANISIISDTSCDK
SYPGRLTNTMVCAGAEGRGAESCE
Download sequence
Identical sequences H2NZT6
ENSPPYP00000011529 ENSPPYP00000011529 9600.ENSPPYP00000011529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]