SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011530 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011530
Domain Number 1 Region: 18-203
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.1e-58
Family Eukaryotic proteases 0.0000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011530   Gene: ENSPPYG00000010299   Transcript: ENSPPYT00000011973
Sequence length 207
Comment pep:known_by_projection chromosome:PPYG2:19:52437450:52441975:1 gene:ENSPPYG00000010299 transcript:ENSPPYT00000011973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVLVVFLTLSVTWIKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPG
DDSSHDLMLLRLSEPAEITDAVKVMDLPTQEPALGTTCYASGWGSIEPDEFLIPKKLQCV
DLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPC
ALPERPSLYTKVVYYRKWIKDTIVANP
Download sequence
Identical sequences H2NZT7
ENSPPYP00000011530 9600.ENSPPYP00000011530 ENSPPYP00000011530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]