SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011533 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011533
Domain Number 1 Region: 16-204
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.1e-59
Family Eukaryotic proteases 0.00000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011533   Gene: ENSPPYG00000010300   Transcript: ENSPPYT00000011976
Sequence length 207
Comment pep:known_by_projection chromosome:PPYG2:19:52457933:52466827:1 gene:ENSPPYG00000010300 transcript:ENSPPYT00000011976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVLVLFIALPVGCTNSQVWLGRHNLFEPEDTGQRVPVSHSFPYPLYNMSLLKRRSLRPD
EDSSHDLMLLRLSEPAKITDAVKVLGLPTQEPALGTTCYASGWGSIQPEEFLRPKSLQCV
SLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPC
ALPEKPAVYTKVVHYQKWIKDTISANP
Download sequence
Identical sequences H2NZU0
ENSPPYP00000011533 9600.ENSPPYP00000011533 ENSPPYP00000011533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]