SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011536 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011536
Domain Number 1 Region: 9-195
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-60
Family Eukaryotic proteases 0.0000000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011536   Gene: ENSPPYG00000010302   Transcript: ENSPPYT00000011979
Sequence length 197
Comment pep:known_by_projection chromosome:PPYG2:19:52566759:52577506:-1 gene:ENSPPYG00000010302 transcript:ENSPPYT00000011979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTA
AHCKKPNLQVFLGKHNLRQRESSQEQSSVVRAVIHPGYDAASHDQDIMLLRLARPAKLSE
LIQPLPLERDCSATTSCHILGWGKTADGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVY
TNVCRYTNWIQKTIQAK
Download sequence
Identical sequences H2NZU3
9600.ENSPPYP00000011536 ENSPPYP00000011536 ENSPPYP00000011536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]