SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011537 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011537
Domain Number 1 Region: 11-251
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-80
Family Eukaryotic proteases 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011537   Gene: ENSPPYG00000010303   Transcript: ENSPPYT00000011980
Sequence length 253
Comment pep:known chromosome:PPYG2:19:52583856:52591412:-1 gene:ENSPPYG00000010303 transcript:ENSPPYT00000011980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSLLLPLQILLLSLALETAGEEGQGDKIIDGAPCTRGSHPWQVALLSGNQLHCGGVLV
NERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNS
QARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY
KDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK
FTKWINDTIKKHR
Download sequence
Identical sequences H2NZU4
ENSPPYP00000011537 ENSPPYP00000011537 XP_009231232.1.23681 9600.ENSPPYP00000011538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]