SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011541 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011541
Domain Number 1 Region: 8-249
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.59e-79
Family Eukaryotic proteases 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011541   Gene: ENSPPYG00000010305   Transcript: ENSPPYT00000011984
Sequence length 250
Comment pep:novel chromosome:PPYG2:19:52612753:52618580:-1 gene:ENSPPYG00000010305 transcript:ENSPPYT00000011984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLT
AAHCRKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQ
ARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYP
GHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHY
LDWIQETMEN
Download sequence
Identical sequences H2NZU8
XP_009231239.1.23681 ENSPPYP00000011541 9600.ENSPPYP00000011541 ENSPPYP00000011541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]