SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011542 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011542
Domain Number 1 Region: 46-275
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.06e-69
Family Eukaryotic proteases 0.0000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011542   Gene: ENSPPYG00000010306   Transcript: ENSPPYT00000011985
Sequence length 276
Comment pep:known_by_projection chromosome:PPYG2:19:52623221:52628151:-1 gene:ENSPPYG00000010306 transcript:ENSPPYT00000011985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAVLLPQNDTRLDPEAYGAPCARGSQPWQ
VSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSFVHPK
YHQGSGPILPRRTDEHDLMLLKLARPVVPGPRIRALQLPYHCAQPGDQCQVAGWGTTAAR
RVKYNKGLTCSNVTILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQ
GILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Download sequence
Identical sequences H2NZU9
ENSPPYP00000011542 9600.ENSPPYP00000011542 ENSPPYP00000011542 XP_002829677.1.23681 XP_009231240.1.23681 XP_009231241.1.23681 XP_009231242.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]