SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011543 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011543
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-60
Family Eukaryotic proteases 0.0000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011543   Gene: ENSPPYG00000010307   Transcript: ENSPPYT00000011986
Sequence length 203
Comment pep:known_by_projection chromosome:PPYG2:19:52641887:52646832:-1 gene:ENSPPYG00000010307 transcript:ENSPPYT00000011986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDRKWVLTA
AHCSGSRYWVRLGEHSLSQLDWTEQIRRSSFSVTHPGYLGASTSHEHDLRLLRLRLPVRI
TSSVQPLPLPNDCATAGTECHISGWGITNHPWNPFPDLLQCLNLSIVSHATCHDVYPGRI
TSNMVCAGGVPGQDACQGDSGGP
Download sequence
Identical sequences H2NZV0
ENSPPYP00000011543 9600.ENSPPYP00000011543 ENSPPYP00000011543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]