SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011544 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011544
Domain Number 1 Region: 4-263
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.68e-84
Family Eukaryotic proteases 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011544   Gene: ENSPPYG00000010308   Transcript: ENSPPYT00000011987
Sequence length 277
Comment pep:known_by_projection chromosome:PPYG2:19:52673517:52683396:-1 gene:ENSPPYG00000010308 transcript:ENSPPYT00000011987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLALVIACLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLL
CGGVLVHPKWVLTAAHCLKDGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN
HDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCAN
IQLRSDEECHQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLCGIVSWGDFPCG
QPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ
Download sequence
Identical sequences H2NZV1
ENSPPYP00000011544 ENSPPYP00000011544 9600.ENSPPYP00000011544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]