SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011545 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011545
Domain Number 1 Region: 37-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-73
Family Eukaryotic proteases 0.0000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011545   Gene: ENSPPYG00000010309   Transcript: ENSPPYT00000011988
Sequence length 246
Comment pep:known_by_projection chromosome:PPYG2:19:52695956:52704676:-1 gene:ENSPPYG00000010309 transcript:ENSPPYT00000011988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRVLGSGTWPSAPKMFLLLTALQVLSIAMTRSQEDENKIIGGYTCTRSSQPWQAALLA
GPRHRFLCGDTLLSDQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYK
SRTHDNDLMLLRLKQPARIGRAVRPIEVTQARYPASLQCVNINISPDEVCQKAYPRAITP
GMVCAGVAQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIE
ETMRDK
Download sequence
Identical sequences H2NZV2
ENSPPYP00000011545 9600.ENSPPYP00000011545 ENSPPYP00000011545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]