SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011680 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011680
Domain Number 1 Region: 11-190
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.7e-46
Family Isochorismatase-like hydrolases 0.0000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011680   Gene: ENSPPYG00000010422   Transcript: ENSPPYT00000012125
Sequence length 204
Comment pep:known chromosome:PPYG2:19:57350170:57353839:-1 gene:ENSPPYG00000010422 transcript:ENSPPYT00000012125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPSLGRVLPGSSILFLCDMQEKFHNIAYFPQIVSVAARMLMVARLLEVPVMLTEQY
PQGLGPTVPELGAEGLRPLAKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILNTTLD
LLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVGDAAHPQFKEIQ
KLIKEPAPDSGLLGLFQGQNSLLH
Download sequence
Identical sequences H2P083
ENSPPYP00000011680 9600.ENSPPYP00000011680 ENSPPYP00000011680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]