SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011935 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011935
Domain Number 1 Region: 1-40,70-261
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-71
Family Eukaryotic proteases 0.0000000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011935   Gene: ENSPPYG00000010674   Transcript: ENSPPYT00000012405
Sequence length 262
Comment pep:known_by_projection chromosome:PPYG2:1_random:32752944:32763053:1 gene:ENSPPYG00000010674 transcript:ENSPPYT00000012405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLQYSSNGKWYHTCGGSLIANNWVLTAAHCISQSMVQCAHKVLQCCSLILFIVRDLCSS
QLELTRVSAGSSRTYRVGLGRHNLYVAESGTLAVSVSHIVVHPDWNSKLSEGNDIALLKL
ANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGALPDVLQQGRLLVVDYATCS
SSGWWGSSVKTNMICAGGDGVISSCNGDSGGPLNCQASDGRWEVHGIVSFGYILGCNYYH
KPSVFTRVSNYNDWINSVIANN
Download sequence
Identical sequences H2P0Y0
9600.ENSPPYP00000011935 ENSPPYP00000011935 ENSPPYP00000011935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]