SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012027 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012027
Domain Number 1 Region: 28-188
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-20
Family C-type lectin domain 0.0035
Further Details:      
 
Domain Number 2 Region: 351-466
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000135
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 255-382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012027   Gene: ENSPPYG00000010763   Transcript: ENSPPYT00000012502
Sequence length 650
Comment pep:known_by_projection chromosome:PPYG2:20:18261504:18267019:-1 gene:ENSPPYG00000010763 transcript:ENSPPYT00000012502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATFMGLLLLLLLSQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCSQNGGNLAT
VKSEEEAQDVQRVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGED
TPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPSSPGSNIEGFVCKF
SFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAATVACGEGDKDESQSHYFLCKE
KAPGVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCAS
RNPCSSSPCRGGATCILGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTP
GGFRCECWVGYEPGGPGEGACRDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDG
TQCQDVDECLGLGGPFCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPD
EEYKGEKEGSTVPPAATASPTRGPEGTPKATSTARRPSLSSDAPITSDPLKMLAPSGSPG
VWREPSIHHATAASGPQEPAGGDSSVAAQNNDGTDGQKLLLFYILGTVVAILLLLALALG
LLVYRKRRAKREEKKQKKPQNAADSYSWVPERAESRAMENQYSPTPGTDC
Download sequence
Identical sequences H2P168
XP_002830062.1.23681 ENSPPYP00000012027 9600.ENSPPYP00000012027 ENSPPYP00000012027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]