SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012573 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012573
Domain Number 1 Region: 79-182
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.44e-17
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012573   Gene: ENSPPYG00000011255   Transcript: ENSPPYT00000013071
Sequence length 202
Comment pep:known_by_projection chromosome:PPYG2:20:62415456:62420724:-1 gene:ENSPPYG00000011255 transcript:ENSPPYT00000013071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTELRSKLSPPRGRAGAVRAGFGDRRDVDATAHFSFCRTLLEHTVSAESIPCHLPRTPG
TSLTWHDSRSQRAASSRPIKLLQQPGTETPQGRLYSDHYGLYHTSPSLGGLTRPVVLWSQ
QDVCKWLKKHCPHNYLVYVEAFSQHAITGRALLRLNAEKLQRMGLAQEAQRQEVLQQVLR
LQVREEGRSLQLLSQASFGKMS
Download sequence
Identical sequences H2P2N6
9600.ENSPPYP00000012573 ENSPPYP00000012573 ENSPPYP00000012573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]