SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012620 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012620
Domain Number 1 Region: 37-187
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-31
Family C-type lectin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012620   Gene: ENSPPYG00000011298   Transcript: ENSPPYT00000013120
Sequence length 273
Comment pep:novel chromosome:PPYG2:21:18050585:18076747:1 gene:ENSPPYG00000011298 transcript:ENSPPYT00000013120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRVVSLLLGAALLCGHGAFCRRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLA
CESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQ
WSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKY
EPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPNLIYVVIPTIPLLLLILVAFGTCCF
QMLHKSKGRTKTSPNQSTLWISKSTRKESGMEV
Download sequence
Identical sequences A0A2I3RYF8 G3RZ27 H2P2T1 Q9H9P2
NP_079220.2.87134 NP_079220.2.92137 XP_001156423.1.37143 XP_004062659.2.27298 gi|20127636|ref|NP_079220.2| ENSGGOP00000021069 ENSPTRP00000023778 ENSGGOP00000021069 390225 NYSGRC-LECT-ENSP00000299295 ENSPPYP00000012620 ENSP00000382993 ENSP00000299295 ENSPTRP00000023778 9598.ENSPTRP00000023778 9600.ENSPPYP00000012620 9606.ENSP00000299295 ENSP00000299295 ENSPPYP00000012620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]