SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012766 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012766
Domain Number 1 Region: 190-435
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.82e-85
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000157
Family Hepsin, N-terminal domain 0.091
Further Details:      
 
Domain Number 3 Region: 112-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012766   Gene: ENSPPYG00000011438   Transcript: ENSPPYT00000013280
Sequence length 442
Comment pep:known_by_projection chromosome:PPYG2:21:42648535:42691358:-1 gene:ENSPPYG00000011438 transcript:ENSPPYT00000013280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVAPSVYEVHPAQYYPSPVPQYAPRVLTQA
SNPVVHTQPKSPLGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSDSGIEC
NSSGTCISPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGYCGVNLNSRHSRIVGGQSALPGAWPWQVSLHVQNVHVCGGSIITREWIVTA
AHCVEKPLNNPWHWTAFAGILRQSFMFYESGHRVEKVISHPNYDSKTKNNDIALMKLQTP
LTFNDLVKPVCLPNPGMMLEPEQPCWISGWGATEEKGKTSDVLNEAMVPLIETQRCNSRY
VYDNLITPAMICAGFLQGTVDSCQGDSGGPLVTWKDNVWWLIGDTSWGSGCAKAYRPGVY
GNVTVFTDWIYRQMRVTILSSF
Download sequence
Identical sequences H2P372
ENSPPYP00000012766 ENSPPYP00000012766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]