SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012784 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012784
Domain Number 1 Region: 230-476
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-88
Family Eukaryotic proteases 0.0000442
Further Details:      
 
Domain Number 2 Region: 131-237
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-19
Family Hepsin, N-terminal domain 0.06
Further Details:      
 
Domain Number 3 Region: 97-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000956
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012784   Gene: ENSPPYG00000011452   Transcript: ENSPPYT00000013299
Sequence length 481
Comment pep:known chromosome:PPYG2:21:43698407:43729997:-1 gene:ENSPPYG00000011452 transcript:ENSPPYT00000013299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSTFSGLGNYEVEVEVEPDVRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDA
DAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYKCRSSFKCIELTARCD
GVSDCKDGEDEYRCVRVSGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSS
DNLRLSSLEGQFREEFVSINHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGY
SSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIVTAAHCVYDLYLPKSWTIQVG
LVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEVIQPVCLPNSEENFP
DGKVCWTSGWGATEDGAGDASPVLNHAAIPLISNKICNHRDVYGGIISPSMLCAGYLKGG
VDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLK
T
Download sequence
Identical sequences H2P390
ENSPPYP00000012784 ENSPPYP00000012784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]