SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012859 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012859
Domain Number 1 Region: 1430-1533
Classification Level Classification E-value
Superfamily C-type lectin-like 1.48e-41
Family Endostatin 0.00000209
Further Details:      
 
Domain Number 2 Region: 450-646
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-35
Family Trypanosoma sialidase, C-terminal domain 0.076
Further Details:      
 
Domain Number 3 Region: 327-442
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.71e-26
Family Frizzled cysteine-rich domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012859   Gene: ENSPPYG00000011521   Transcript: ENSPPYT00000013379
Sequence length 1535
Comment pep:known_by_projection chromosome:PPYG2:21:47042376:47109624:1 gene:ENSPPYG00000011521 transcript:ENSPPYT00000013379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPDPRGCRILLLLFCSLAAARADLLNLNWLWFNNEDTSHAATTIPEPQGPLPAQPTHMA
PRNGSTEPATVPGSPEPPSELLEDGQDTPTSAESPDTPEENIAGVGAKILNVAQGIRSFV
QLWNDTVPTESLTRVETLVLETPVGPFALPGPSSTPQENGTTLWPSRGTPSSPGAHTTEA
GTLPAPTPSPPSLGRPWAPLTGPSVPPSSSGRASLSSLLGGAPPWGSLQDPDSQGLSPAA
AAASQQLQRPDVRLRTPLLHPLVTGSLGKHAAPSAFSSGLPGALSQVAITTLIGDSGAWV
SHAANSAGPGLANNSALLRADPKAPAGRCLPLPPSLPVCGRLGISRSWLPNHLHHESGEQ
VRAGAQAWGGLLRTRCHPFLAWFFCLLLAPPCGSVPPPTPPPCRQFCEALQDACWSRLSG
GRLPVACASLLTQEDGYCVFIGPAARVSEEVGLLQLLGDPPPQQVTQTDDPDVGLAYVFG
PDANSGQVARYHFPSLFFRDFSLLFHIRPATEGPGVLFAITDSAQAVVLLGVKLSGVQDG
HQDISLLYTEPGAGQTHTAASFRLPAFVGQWTHLALSVEGGYVTLYVDCEEFQRMLLARS
SRGLELEPGAGLFVAQAGGADPDKFQGMIAELKVRGDPQVSPMHCLDEEGDDSDGASGDF
GSGLGDARELLREETQTLPGSDSVSTWDGSVRTPGDRVREGGLKGQKGEPGVPGPPGRAG
PPGPCLPGPPGLPCPVSPLDRAGPAGDTGPQGFPGTPGDVGPKGDKGDPGVGERGPPGPQ
GPPGPPGPSFRHDKLTFIDMEGSGFGGDLEALRGPRGFPGPPGPPGVPGLPGEPGRFGVN
SSDVPGPAGLPGVPGREGPPGFPGLPGPPGPPGREGPPGRTGQKGSLQGSKGDPGPAGAR
GESGLAGSPGPAGPPGPPGPPGPPGPGLPAGFDDMEGSGGPFWSTARSADGPQGPPGLPG
LKGDPGVPGLPGAKGEIGADGAPGFPGLPGREGIAGPQGPKGDRGSQGEKGDPGKDGVGQ
PGLPGPPGPPGPVVYVSEQDGSVLSVPGPEGRPGFAGFPGPAGPKGDLGSKGERGSPGPK
GEKGEPGSIFRPDGGALGPVQKGAKGEPGFRGPPGPYGRPGYKGEIGFPGRPGRPGMNGL
KGEKGEPGDASLGFGMRGMPGPPGPPGPPGPPGTPVYDSNVFAESSRPGPPGMPGNQGPP
GPKGAKGEVGPPGPPGQFPFDFLQLEAEMKGEKGDRGDAGQKGERGEPGGGGFFGSRLPG
PPGPPGPPGYPGIPGPKGESIRGQPGPPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPH
RQTISVPGPPGPPGPPGPPGTVGASSGVRLWATRQAMLGQVHEVPEGWLIFVAEQEELYV
RVRNGFRKVQLEARTPLPRGTPGAPHHSSYVHFTARPTSPPAHTHRDFQPVLHLVALNSP
LSGSMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDEL
LFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPT
Download sequence
Identical sequences H2P3G5
ENSPPYP00000012859 9600.ENSPPYP00000012859 ENSPPYP00000012859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]