SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012907 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012907
Domain Number 1 Region: 104-267
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-19
Family C-type lectin domain 0.0069
Further Details:      
 
Domain Number 2 Region: 25-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000012907
Domain Number - Region: 266-331
Classification Level Classification E-value
Superfamily FnI-like domain 0.000889
Family VWC domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012907   Gene: ENSPPYG00000011571   Transcript: ENSPPYT00000013434
Sequence length 551
Comment pep:known chromosome:PPYG2:22:14911491:15030842:-1 gene:ENSPPYG00000011571 transcript:ENSPPYT00000013434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQCDGWATCEDE
SDEANCPEVTGEVRPHHGKEAVDPRQGRARGGDPTHFHAVNVAQPVRFSSFLGKCPTGWH
HYEGTASCYRVYLSGENYWDAAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKD
QRKLWVGYQYVITGRNHSLEGRWEVAFKGNSEVFLPPDPIFASAMSENDNVFCAQLQCFH
FPTLRHHANFHSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCH
GGEPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGNSLFDSMASGMRLVVSCISSFL
ILSLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYGPDGFGTGLTPLHLSDDG
EGGTFHFHDPPPPYTAYKYPDIGQPDDPPPPYEASIHPDSVFYDPADDDAFEPAEVSLPA
PGDGGSEGALPRRLEQPLPTAGASLADLEDSADSSSALLVPPDPAQSGSIPAAEALPGGG
RHSRSSLNTVV
Download sequence
Identical sequences H2P3L2
ENSPPYP00000012907 ENSPPYP00000012907 9600.ENSPPYP00000012907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]