SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012925 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012925
Domain Number 1 Region: 37-384
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.12e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000104
Further Details:      
 
Domain Number 2 Region: 392-520
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 8.25e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012925   Gene: ENSPPYG00000011587   Transcript: ENSPPYT00000013452
Sequence length 522
Comment pep:known chromosome:PPYG2:22:15755820:15822253:-1 gene:ENSPPYG00000011587 transcript:ENSPPYT00000013452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQ
LGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPHYGWEVAQP
VLHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLS
ADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGI
GLDTTIMMRSIPLRGFDQQMSSLVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDRA
TGKEDMGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDV
VEGRPELTPTAIMAGRLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEEAVARHG
QEHVEVYHAHYKPLEFTVAGRDASQCYVKMVCLREPPQLLLGLHFLGPNAGEVTQGFALG
IKCGASYAQVMRTVGIHPTCSEEVVKLRISKRSGLDPTVTGC
Download sequence
Identical sequences H2P3M9
9600.ENSPPYP00000012925 ENSPPYP00000012925 ENSPPYP00000012925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]