SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013030 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013030
Domain Number 1 Region: 27-123
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-27
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 211-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013030   Gene: ENSPPYG00000011681   Transcript: ENSPPYT00000013561
Sequence length 467
Comment pep:known_by_projection chromosome:PPYG2:22:23980110:24060977:1 gene:ENSPPYG00000011681 transcript:ENSPPYT00000013561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AHLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQ
HPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCY
KDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAAS
TECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWT
IRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYF
FSDRINQAQGFAVLYQAVKEELPQERPAVNQTVVEVITEQANLSVSAARSSKVLYVITTS
PSHPPQTVPGSNSWVPPMGAGSHRVEGWTVYGLATLLILTVTAIVAKILLHITFKSHRVP
ASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDCNPL
Download sequence
Identical sequences H2P3Y4
ENSPPYP00000013030 ENSPPYP00000013030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]