SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013073 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013073
Domain Number 1 Region: 17-163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-37
Family Dual specificity phosphatase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013073   Gene: ENSPPYG00000011719   Transcript: ENSPPYT00000013606
Sequence length 188
Comment pep:known chromosome:PPYG2:22:25615821:25616387:-1 gene:ENSPPYG00000011719 transcript:ENSPPYT00000013606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTL
YEDIQYLQVPVADAPDSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPMGMIPDIYEK
EVRLMIPL
Download sequence
Identical sequences H2P427
ENSPPYP00000013073 XP_009232522.1.23681 XP_009232523.1.23681 XP_009232524.1.23681 ENSPPYP00000013073 9600.ENSPPYP00000013073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]