SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013087 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013087
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-22
Family Kringle modules 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013087   Gene: ENSPPYG00000011731   Transcript: ENSPPYT00000013620
Sequence length 263
Comment pep:known chromosome:PPYG2:22:26249686:26260584:-1 gene:ENSPPYG00000011731 transcript:ENSPPYT00000013620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAP
VSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEKRPCENLSCPETTSQALPASTTEIEEAS
EGPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDEKTVVVHT
SQTPVDPQEGSTPLMGQAGTPGA
Download sequence
Identical sequences H2P440
9600.ENSPPYP00000013087 ENSPPYP00000013087 ENSPPYP00000013087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]