SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013121 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013121
Domain Number 1 Region: 12-239
Classification Level Classification E-value
Superfamily Heme oxygenase-like 8.62e-76
Family Eukaryotic type heme oxygenase 0.00000000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013121   Gene: ENSPPYG00000011762   Transcript: ENSPPYT00000013656
Sequence length 288
Comment pep:known chromosome:PPYG2:22:30549496:30562749:1 gene:ENSPPYG00000011762 transcript:ENSPPYT00000013656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTREGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALGLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKAQDSAPVETPRGKTPLNTHSQAPLLRWVLTLSFLVATVAVGLYAM
Download sequence
Identical sequences H2P472
ENSPPYP00000013121 9600.ENSPPYP00000013121 ENSPPYP00000013121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]