SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013149 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013149
Domain Number 1 Region: 435-712
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.22e-86
Family Eukaryotic proteases 0.0000876
Further Details:      
 
Domain Number 2 Region: 6-95
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000012
Family SEA domain 0.0063
Further Details:      
 
Domain Number 3 Region: 268-367
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000157
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 4 Region: 166-250
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000144
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 5 Region: 410-446
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000218
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 377-407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000034
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013149   Gene: ENSPPYG00000011787   Transcript: ENSPPYT00000013686
Sequence length 713
Comment pep:known_by_projection chromosome:PPYG2:22:32192837:32231536:-1 gene:ENSPPYG00000011787 transcript:ENSPPYT00000013686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YNAEVTVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKMLKELITSTRLGTYYNS
SSVYSFGEGPLTCFFWFILQIPEHRRPMLSPEVVQALLVEELLSTVNSSAAVPYRAEYEV
DPEGLVILEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDHLASSCLWHLQGPEDLML
KLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVEVLASGAIMAVVWKKGLH
SYYDPFVLSVQPVVFQACEVNLTLDNSLDSQGVFSTPYFPSYYSPRTHCSWHLTVPSLDY
GLALWFASVDASMEQYDACTDQTIQRLCGLRILQPYAERIPVVATAGITINFTSQISLTG
PGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDCPNGLDERNCGVPCGTFTFQCED
RSCVKKPNPQCDGWPDCRDGSDEQHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRH
ICGGALIADRWVITAAHCFQEDSMASPVLWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYH
EEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGALEADAV
ALFYGWRNHGPETCCCPISNALQKVDVQLIPQDLCSEAYRYQVTPRMLCAGYRKGKKDAC
QGDSGGPLVCKALSGRWFLAGLVSWGLGCGRPNYFGVYTRITGVISWIQQVVT
Download sequence
Identical sequences H2P4A0
ENSPPYP00000013149 9600.ENSPPYP00000013149 ENSPPYP00000013149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]