SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013150 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013150
Domain Number 1 Region: 435-690
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-89
Family Eukaryotic proteases 0.0000923
Further Details:      
 
Domain Number 2 Region: 6-95
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000115
Family SEA domain 0.0063
Further Details:      
 
Domain Number 3 Region: 268-367
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000144
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 4 Region: 166-250
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000131
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 5 Region: 410-446
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000218
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 377-407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013150   Gene: ENSPPYG00000011787   Transcript: ENSPPYT00000013687
Sequence length 691
Comment pep:known_by_projection chromosome:PPYG2:22:32192837:32231536:-1 gene:ENSPPYG00000011787 transcript:ENSPPYT00000013687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YNAEVTVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKMLKELITSTRLGTYYNS
SSVYSFGEGPLTCFFWFILQIPEHRRPMLSPEVVQALLVEELLSTVNSSAAVPYRAEYEV
DPEGLVILEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDHLASSCLWHLQGPEDLML
KLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVEVLASGAIMAVVWKKGLH
SYYDPFVLSVQPVVFQACEVNLTLDNSLDSQGVFSTPYFPSYYSPRTHCSWHLTVPSLDY
GLALWFASVDASMEQYDACTDQTIQRLCGLRILQPYAERIPVVATAGITINFTSQISLTG
PGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDCPNGLDERNCGVPCGTFTFQCED
RSCVKKPNPQCDGWPDCRDGSDEQHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRH
ICGGALIADRWVITAAHCFQEDSMASPVLWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYH
EEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGGPISNAL
QKVDVQLIPQDLCSEAYRYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSGRWFLAGL
VSWGLGCGRPNYFGVYTRITGVISWIQQVVT
Download sequence
Identical sequences H2P4A1
ENSPPYP00000013150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]