SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013384 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013384
Domain Number 1 Region: 26-295
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-85
Family Eukaryotic proteases 0.0000000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013384   Gene: ENSPPYG00000011999   Transcript: ENSPPYT00000013930
Sequence length 349
Comment pep:known_by_projection chromosome:PPYG2:22:46448194:46454199:1 gene:ENSPPYG00000011999 transcript:ENSPPYT00000013930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSL
QIFTYNSHRYHACGGSLLNSRWVLTAAHCFVGKNKVHDWRLVFGAKEITYGNNKPVKAPV
QERYVEKIIIHEKYNSATEGDDIALVKITPPISCGSFIGPGCLPHFKAGLPRGSQSCWVA
GWGYIEEKAPRPSSMLMEARVDLIDLDLCNSTQWYNGRVQPTNMCAGYPVGKIDTCQGDS
GGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWPYLNWIASKIGSNALHMIQPA
TPPPPTTRPPPIQPPFSHPISAHLPWYFQPPPRTLAQPRPPPPPPPPPP
Download sequence
Identical sequences H2P4X8
XP_002831364.2.23681 ENSPPYP00000013384 ENSPPYP00000013384 9600.ENSPPYP00000013384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]