SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013659 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013659
Domain Number 1 Region: 37-173
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-38
Family C-type lectin domain 0.0000000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013659   Gene: ENSPPYG00000012248   Transcript: ENSPPYT00000014216
Sequence length 175
Comment pep:known_by_projection chromosome:PPYG2:2a:31318048:31320225:1 gene:ENSPPYG00000012248 transcript:ENSPPYT00000014216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPPMALPSVSWMLLFCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKS
WTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSISNSYSYVWIGLHDPTQGTEPNGDGW
EWSSSDVMNYFAWERNPSTVSSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Download sequence
Identical sequences H2P5P2
XP_002811892.1.23681 XP_002811893.1.23681 9600.ENSPPYP00000013659 ENSPPYP00000013659 ENSPPYP00000013659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]