SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013660 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013660
Domain Number 1 Region: 29-164
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-44
Family C-type lectin domain 0.00000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013660   Gene: ENSPPYG00000012249   Transcript: ENSPPYT00000014217
Sequence length 166
Comment pep:known_by_projection chromosome:PPYG2:2a:31359043:31361982:-1 gene:ENSPPYG00000012249 transcript:ENSPPYT00000014217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTSSYFMLISCLMFLSQSQGQEAKTELPQARISCPEGTNAYGSYCYYFNEDRETWVDA
DLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTGDFNVWIGLHDPKKNRRWHWSSGSLVS
YKSWGIGAPSSVNPGYCVSLTSSSGFWKWKDVPCEDKFSFVCKFKN
Download sequence
Identical sequences H2P5P3
ENSPPYP00000013660 XP_002811895.1.23681 ENSPPYP00000013660 9600.ENSPPYP00000013660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]