SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013676 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013676
Domain Number 1 Region: 147-344
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.8e-57
Family Prokaryotic proteases 0.0000000135
Further Details:      
 
Domain Number 2 Region: 359-455
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-24
Family HtrA-like serine proteases 0.00000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013676   Gene: ENSPPYG00000012266   Transcript: ENSPPYT00000014234
Sequence length 458
Comment pep:known_by_projection chromosome:PPYG2:2a:36167211:36170444:-1 gene:ENSPPYG00000012266 transcript:ENSPPYT00000014234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSETSDPRARVTYGTPSLWAR
LSVGVTELRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLL
LWGGGRGPPAVLAAVPGPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRR
YIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQM
VQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Download sequence
Identical sequences H2P5Q8
ENSPPYP00000013676 ENSPPYP00000013676 XP_002811922.1.23681 9600.ENSPPYP00000013676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]