SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013730 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013730
Domain Number 1 Region: 44-175
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.61e-36
Family Methylmalonyl-CoA epimerase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013730   Gene: ENSPPYG00000012311   Transcript: ENSPPYT00000014288
Sequence length 176
Comment pep:known_by_projection chromosome:PPYG2:2a:39687121:39709360:1 gene:ENSPPYG00000012311 transcript:ENSPPYT00000014288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARALKAAAANALGLFSRLQAPIPTVRASSTSQPLEQVAGSVWNLGRLNHVAIAVPDLEK
AAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGM
HHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA
Download sequence
Identical sequences H2P5W2
ENSPPYP00000013730 XP_002811962.1.23681 9600.ENSPPYP00000013730 ENSPPYP00000013730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]