SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013737 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013737
Domain Number 1 Region: 193-239
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000000455
Family C-type lectin domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000013737
Domain Number - Region: 86-206
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0034
Family HBL-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013737   Gene: ENSPPYG00000012318   Transcript: ENSPPYT00000014296
Sequence length 239
Comment pep:known_by_projection chromosome:PPYG2:2a:39957483:39960659:1 gene:ENSPPYG00000012318 transcript:ENSPPYT00000014296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEREAPDAHFTVDKQNISLWPREPPPKSGPSLLPGKTPAVRAALICLTLVLVASILLQ
AVLYPRFMGTILDVKTNVQLLKGRVDNISTLDSEVKKNSDGVEAAGVQIQMVNVSLGYVR
SQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLEN
MSKLLKRQNDILQVVSQGWKYFRGNFYYFSLISKTWYSAEQFCVSRNSHLTSVTSESEQ
Download sequence
Identical sequences H2P5W9
ENSPPYP00000013737 9600.ENSPPYP00000013737 ENSPPYP00000013737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]