SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013738 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013738
Domain Number 1 Region: 461-555
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-31
Family C-type lectin domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000013738
Domain Number - Region: 94-293
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000471
Family HBL-like 0.04
Further Details:      
 
Domain Number - Region: 220-431
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013738   Gene: ENSPPYG00000012319   Transcript: ENSPPYT00000014297
Sequence length 588
Comment pep:known_by_projection chromosome:PPYG2:2a:39972588:39983828:1 gene:ENSPPYG00000012319 transcript:ENSPPYT00000014297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEAVRFCTDNQCVSLHPQEVDSVATASADPKIPRLVQATPAFMAVTLVFSLVTLFVVV
QQHTRPVPKPVQVVILGDNITGHLPFEPNNYHHFGRETEMRELIQTFKGHMENSSTWVVE
IQMLKCRVDNVNSQLQVLGDHLGNTSADIQMVKGVLKDATTLSLQTHMLRSSLEGTNAEI
QRLKGDLEKADALTFQTLNFLKSSLENTSIELHVLSRGLENANSEIQMLNASLETANAQA
QLANSSLKNANAEIHVLRGHLDSVNDLRTQNQVLRNSLEGANAEIQGLKENLQNTNALNS
QTQAFIKSSFDNTSAEIQFLRGHLERAGDEIHVLKRDLETVTAQTQKANGRLDQTDTQIQ
VFKAEMENANTLNAQIQVLNGHMKNASREIQTLKQGMKNASALTSQTQMLDSNLQKASAE
IQRLRGVLENTKALTVEIQQEQSRLKTLHEVVTSQEQLQRTQSQLLQMVLQGWKFNGGSL
YYFSSVKKSWHEAEQFCVSQGAHLASVASKEEQAFLVEFTSKVYYWIGLTDRGTEGSWRW
TDGTPFNAAQNKAPGSKGSCPLRRYISVNSGVGASFIDTPPCPWILSN
Download sequence
Identical sequences H2P5X0
ENSPPYP00000013738 ENSPPYP00000013738 9600.ENSPPYP00000013738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]