SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013892 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013892
Domain Number 1 Region: 244-346
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.86e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 95-202
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000117
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 11-72
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000135
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013892   Gene: ENSPPYG00000012442   Transcript: ENSPPYT00000014455
Sequence length 869
Comment pep:known_by_projection chromosome:PPYG2:2a:64991702:65081433:-1 gene:ENSPPYG00000012442 transcript:ENSPPYT00000014455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQN
FEESSAYGKAILPPSQPWATELRSPSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSCST
PNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQ
LSPICPEERLLVENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEH
RPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEF
VGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQD
LSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLP
LPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTR
YDCEVNVPVLGSSTLLQGGDLLRALDQAT
Download sequence
Identical sequences H2P6B8
XP_002812111.1.23681 9600.ENSPPYP00000013892 ENSPPYP00000013892 ENSPPYP00000013892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]