SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013980 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013980
Domain Number 1 Region: 90-403
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.16e-48
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000021
Further Details:      
 
Domain Number 2 Region: 397-544
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.44e-22
Family Ricin B-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013980   Gene: ENSPPYG00000012516   Transcript: ENSPPYT00000014547
Sequence length 547
Comment pep:known chromosome:PPYG2:2a:80914403:81149892:1 gene:ENSPPYG00000012516 transcript:ENSPPYT00000014547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLTRRLVLPVFGVLWITVLLFFWVTKRKLEVPTGPEVQTPKPSDADWDDLWDQFDERR
YLNAKKWRVGDDPYKLYAFNQRESERISSNRAVPDTRHLRCTLLVYCTDLPPTSIIITFH
NEARSTLLRTIRSVLNRTPTHLIREIILVDDFSNDPDDCKQLIKLPKVKCLRNNERQGLV
RSRIRGADISKRGTTLTFLDSQVCRLCDWLQPLHEVKEDYTRVVCPVIDIINLDTFTYIE
SASELRGGFDWSHFQWEQLSSEQKARRLDPTEPIRTPIIAGGLFVIDKAWFDYLGKYDMD
MDWGGENFEISFRVWMCGSLEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWM
DEYKQYYYAARPFALERPFGNVESRLDLRKNLAAFKWYLEEMYPLACIPKESSIQKGNRQ
RQKCLESQRQSNKPPNLSKLSPCAKVKGEDAKSTRVWAFTYTQQILQEELCLSVITLFPG
APVVLVLCKNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTENSKEIVVNPCESSLMSQ
HWDMVSS
Download sequence
Identical sequences H2P6K4
9600.ENSPPYP00000013980 ENSPPYP00000013980 ENSPPYP00000013980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]