SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014127 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014127
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 8.41e-72
Family Alanine racemase-like, N-terminal domain 0.000000000552
Further Details:      
 
Domain Number 2 Region: 262-424
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.84e-49
Family Eukaryotic ODC-like 0.000000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014127   Gene: ENSPPYG00000012654   Transcript: ENSPPYT00000014699
Sequence length 461
Comment pep:known_by_projection chromosome:PPYG2:2a:102241520:102250071:1 gene:ENSPPYG00000012654 transcript:ENSPPYT00000014699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKAVP
RVTPFYAVKCNDSKAIVKTLAAVGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLL
LERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKMVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
QNPDFPPEVEEQDASTLPVSCARESGMKRHRAACASASINV
Download sequence
Identical sequences H2P6Z1
ENSPPYP00000014127 ENSPPYP00000014127 9600.ENSPPYP00000014127 XP_002812342.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]