SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014244 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014244
Domain Number 1 Region: 121-416
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.47e-80
Family Eukaryotic proteases 0.00000000405
Further Details:      
 
Domain Number 2 Region: 63-115
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000000000875
Family GLA-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014244   Gene: ENSPPYG00000012767   Transcript: ENSPPYT00000014824
Sequence length 427
Comment pep:novel chromosome:PPYG2:2b:6663646:6675119:-1 gene:ENSPPYG00000012767 transcript:ENSPPYT00000014824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGRQTCSISTTRLCASASGMWRLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRI
RKRANSFLEELRPSSLERECIEEICDFEEAKEIFQNVDDTVSFLNCSLDNGGCTHYCLEE
VGWRRCSCAPGYKLGDDLLQCQPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLID
GKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWE
KWELDLDIEEVFVHPNYSKSTTDNDIALLRLAQPATLSQTIVPICLPDSGLAERELNQAG
QETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDR
QDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWVHGHIRAKEA
PRKSWAP
Download sequence
Identical sequences H2P7A3
ENSPPYP00000014244 ENSPPYP00000014244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]