SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014256 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014256
Domain Number 1 Region: 45-116
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000000000000916
Family Ribosomal protein L11, C-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.00000000000719
Family Ribosomal L11/L12e N-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014256   Gene: ENSPPYG00000012775   Transcript: ENSPPYT00000014836
Sequence length 133
Comment pep:novel chromosome:PPYG2:2b:12934515:12935015:1 gene:ENSPPYG00000012775 transcript:ENSPPYT00000014836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKFNPKEIKVVYLRCTGGEVGAMSALAPRLAPWNRQAQIEVVPSASALIIKALKEPQD
RKKQKNIKHSGNITFDEIINIAQQMWHRSRSRELSGTIKEILGTASLGCNVDGRHPHEII
DDINSGAVECPAS
Download sequence
Identical sequences H2P7B5
9600.ENSPPYP00000014256 ENSPPYP00000014256 ENSPPYP00000014256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]