SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014339 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014339
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-38
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 5.08e-37
Family Link domain 0.00000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014339   Gene: ENSPPYG00000012845   Transcript: ENSPPYT00000014922
Sequence length 277
Comment pep:known_by_projection chromosome:PPYG2:2b:40756978:40779457:1 gene:ENSPPYG00000012845 transcript:ENSPPYT00000014922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEF
EGGQLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDPKRMFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDF
DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGF
QIKYVAVDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences H2P7J4
XP_002812522.1.23681 ENSPPYP00000014339 9600.ENSPPYP00000014339 ENSPPYP00000014339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]