SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014354 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014354
Domain Number 1 Region: 475-802
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.33e-63
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000212
Further Details:      
 
Domain Number 2 Region: 808-935
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.13e-20
Family Ricin B-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014354   Gene: ENSPPYG00000012861   Transcript: ENSPPYT00000014938
Sequence length 940
Comment pep:known_by_projection chromosome:PPYG2:2b:46911912:46973824:1 gene:ENSPPYG00000012861 transcript:ENSPPYT00000014938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRIRKFFRGSGRVLAFIFVASVIWLLFDMAALRLSFSEINTRVIKEDIVRRERIGFRVQ
PDQGKIFYSSIKEMKPPLRGHGKGAWGKENVRKTEESVLKVEVDLDQTQRERKMQNALGR
GKVLPLWHPAHLQTLPVTPNKQKTDGRGTKPEASSHQGTPKQTTAQGAPKISFIAAKGTQ
VVKISVHMGRVSLKQEPLKSHSPSSDTSKLAAERDLNVTISLSTDRPKQRSQAVAKERAH
PASTAVPKSGEAMALNKTKTQSKEVNANKHKANRSLPFPKFIVNSNRLRKQSINETPLGS
LSKDDGARGAHGKKLNFSESHFVIITKEEEQKADPKEVSNSKTKTIFPKVLGKSQGKHIS
RNRSEMSFSSLAPQKVSLSQTNHALTGGLEPAKINITAKAPPTEYNQSHIKALLPEDSGM
HQVLRIDVTLSPRDPKAPGQFGRPVVVPHGKEKEAERRWKEGNFNVYLSDLIPVDRAIED
TRPAGCAEQLVHNNLPTTSVIMCFVDEVWSTLLRSVHSVLNRSPPHLIKEILLVDDFSTK
DYLKDNLDKYMSQFPKVRILRLKERHGLIRARLAGAQNATGDVLTFLDSHVECNVGWLEP
LLERVYLSRKKVACPVIEVINDKDMSYMTVDNFQRGIFVWPMNFGWRTIPPDVIAKNRIK
ETDTIRCPVMAGGLFSIDKSYFFELGTYDPGLDVWGGENMELSFKVWMCGGEIEIIPCSR
VGHIFRNDNPYSFPKDRMKTVERNLVRVAEVWLDEYKELFYGHGDHLIDQGLDAGNLTQQ
RELRKKLKCKSFKWYLENVFPDLKAPIVRASGVLINVALGKCISIENTTVILEDCDGSKE
LQQFNYTWLRLIKCGEWCIAPIPDKGAVRLHPCDNRNKGLKWLHKSTSVFHPELVNHIVF
ENSQQLLCLEGNFSQKILKVAACDPVKPYQKWKFEKYYEA
Download sequence
Identical sequences H2P7K9
ENSPPYP00000014354 9600.ENSPPYP00000014354 ENSPPYP00000014354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]