SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014368 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014368
Domain Number 1 Region: 374-504
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-34
Family C-type lectin domain 0.00086
Further Details:      
 
Domain Number 2 Region: 174-359
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-30
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 1241-1381
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-30
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 4 Region: 807-939
Classification Level Classification E-value
Superfamily C-type lectin-like 1.47e-29
Family C-type lectin domain 0.00095
Further Details:      
 
Domain Number 5 Region: 1117-1237
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-28
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 6 Region: 954-1100
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-27
Family C-type lectin domain 0.00058
Further Details:      
 
Domain Number 7 Region: 659-800
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-25
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 8 Region: 37-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.62e-24
Family Cysteine rich domain 0.01
Further Details:      
 
Domain Number 9 Region: 510-646
Classification Level Classification E-value
Superfamily C-type lectin-like 1.71e-22
Family C-type lectin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014368   Gene: ENSPPYG00000012876   Transcript: ENSPPYT00000014954
Sequence length 1463
Comment pep:known chromosome:PPYG2:2b:49687796:49826926:-1 gene:ENSPPYG00000012876 transcript:ENSPPYT00000014954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLT
LENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCDRK
MITGPLQYSVQVAHDNTVVASRKYFHKWISYGSGGGDICEYLHKDLHTIKGNAHGMPCMF
PFQYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSH
ICYQFNLLSSLSWSEAHSSCQMQGGALLSITDETEENFIREHMSSKTVEVWMGLNQLDEH
AGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFIPSAWRSRDCASTLPYVCKKYLNH
IDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA
EVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPQIFPNRSQLCVS
AEQSEGHWKVKNCEETLFYVCKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQAS
SGYYCPPALVTITNRFEQAFITSLIGSVVKMKDSYFWIALQDQNDTGEYTWKPAGQKPEP
VQYTHWNAHQPRYSGGCVAMRGRHPPGRWEVKHCRHFKAMSLCKQPVENQEKAEYEERWP
FHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCEEFGAHLASFAHIEEENFVNE
LLYSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNNYFGEDARNCAVYKAN
KTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC
SWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWD
TGRERSVNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKVLLIEKKKDTPKQHGTCPK
GWLYFNYKCLLLNIPKDPNSWKNWMHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTN
VWIGLQNDDYETWLNGKPVVYSNWSPFDIINIPSHNTTDVQKHIPLCALLSSNPNFHFTG
KWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLEYGNRTYKIINANMTWYAAIK
TCLMHGTQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKD
EESSLLGDCVFADTNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSN
CYSFSTVLDGMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFD
GNNETIKWFDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSLCQEKKGFICKME
ADIRTAEELPEKGPSHSIIPLAVVLTLIVIVAICTLSFCIYKHNGGFFRRLAGFRNPYYP
ATNFSTVHLEENILISDLEKSDQ
Download sequence
Identical sequences H2P7M3
9600.ENSPPYP00000014368 ENSPPYP00000014368 ENSPPYP00000014368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]