SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014391 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000014391
Domain Number - Region: 196-228
Classification Level Classification E-value
Superfamily Kringle-like 0.0593
Family Kringle modules 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014391   Gene: ENSPPYG00000012893   Transcript: ENSPPYT00000014977
Sequence length 384
Comment pep:known_by_projection chromosome:PPYG2:2b:54788004:54846339:-1 gene:ENSPPYG00000012893 transcript:ENSPPYT00000014977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQAGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQF
LYPFIVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAKLGKVSLISTGLTTLILGIVMAR
AISLGPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHNSFLVYSSLEEPTVAKWSRLIHM
SIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDLVTFGRFCYGVTVILTYPMECFV
TREVIANVFFGGNLSSVFHIVVTVMVITVATLVSLLIDCLGIVLELNGVLCATPLIFIIP
SACYLKLSEEPRTHSDKIMSCVMLPIGAVVMVFGFVMAITNPQDCTHGQEMFYCFPDNFS
LTNTSESHVPQTTQLSILNISIFQ
Download sequence
Identical sequences H2P7P5
ENSPPYP00000014391 ENSPPYP00000014391 9600.ENSPPYP00000014391 XP_002812576.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]