SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014394 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014394
Domain Number 1 Region: 166-495
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.72e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000228
Further Details:      
 
Domain Number 2 Region: 497-629
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.86e-31
Family Ricin B-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014394   Gene: ENSPPYG00000012896   Transcript: ENSPPYT00000014980
Sequence length 633
Comment pep:known_by_projection chromosome:PPYG2:2b:55574490:55596542:-1 gene:ENSPPYG00000012896 transcript:ENSPPYT00000014980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLKRLVKLHIKRHYHKRFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKN
KMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNA
PGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKR
CPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYV
KQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTA
VVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTP
TFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSK
SPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRL
QCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGG
NQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQMWEIQKDQLLYNP
FLKMCLSANGEHPSLVSCDPSDPLQKWIFSQND
Download sequence
Identical sequences H2P7P8
ENSPPYP00000014394 ENSPPYP00000014394 XP_002812581.1.23681 XP_002812582.1.23681 XP_002812583.1.23681 9600.ENSPPYP00000014394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]