SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014646 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014646
Domain Number 1 Region: 243-661
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 8.17e-84
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00042
Further Details:      
 
Domain Number 2 Region: 105-241
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.76e-37
Family Ferredoxin domains from multidomain proteins 0.00024
Further Details:      
 
Domain Number 3 Region: 32-104
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.56e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014646   Gene: ENSPPYG00000013106   Transcript: ENSPPYT00000015238
Sequence length 728
Comment pep:known chromosome:PPYG2:2b:97639543:97676679:-1 gene:ENSPPYG00000013106 transcript:ENSPPYT00000015238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNR
VDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSA
LQRNDGAAILAAVSIAQKIRMTSGVNWWKTTLSQLHMIASQVAAFGPLAISLGVEAAKNP
PRAAVFSWGADGGCITRQGFAKGIVSIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNT
EGRAQQTKVAVTPPGLAREDWKIIRALSEIAGVTLPYDTLDQVRNRLEEVSPNLVRYDDI
EGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ
AVEEPSIC
Download sequence
Identical sequences H2P8E0
ENSPPYP00000014646 ENSPPYP00000014646 9600.ENSPPYP00000014646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]