SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014791 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014791
Domain Number 1 Region: 1466-1571
Classification Level Classification E-value
Superfamily C-type lectin-like 1.95e-40
Family Noncollagenous (NC1) domain of collagen IV 0.00000444
Further Details:      
 
Domain Number 2 Region: 1573-1687
Classification Level Classification E-value
Superfamily C-type lectin-like 2.83e-39
Family Noncollagenous (NC1) domain of collagen IV 0.00000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014791   Gene: ENSPPYG00000013236   Transcript: ENSPPYT00000015388
Sequence length 1689
Comment pep:known_by_projection chromosome:PPYG2:2b:119104629:119259897:-1 gene:ENSPPYG00000013236 transcript:ENSPPYT00000015388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSLHIVLMRYSFRLTKSLATGPWCDCLLLFSNFYSIKSGKKYVGPCGGRDCSVCHCVPE
KGSRGPPGPPGPQGPIGPLGAPGPIGLSGEKGMRGDRGPPGAAGDKGDKPPASASQVAGI
TGACGHPGPPGPRGKPGMSGHNGSRGDPGFLGGRGALGPGGPPGHPGEKGEKGNSVFILG
AIKGIQVKIGKPIMPSLLGFWGAGGPAGPTGYPGEPGLVDQTQVGSLSMTHRIGSIIPQY
MGEKGEVGQQGSPGPTLLVEPPDFCLYKGEKGIKGIPGMIGLPGPPGRKGESGIGAKGEK
GIPGFPGPRGDPGSYGSPGFPGLKGELGLVGDPGLFGLIGPKGDPGNRGHPGPPGVLVTP
PLPLKGPPGDPGFPGRYGETGDVGPPGPPGLLGRPGEACAGMIGPPGPQGFPGLPGLPGE
AGIPGRPDSAPGKPGKPGSPGLPGEPGLQGLPGSSATYCSVGNPGPQGIKGKVGPPGGRG
SKGEKGNEGLCACEPGPMGPPGPPGLPGRQGSKGDLGIPGWLGTEGDPGSPGAEGPPGLP
GKHGASGPPGNKGAKGDMVVSRVKGHKGERGPDGPPGFPGQPGSHGRDGHAGEKGDPGPP
GDHEDATPGGKGFPGPLGPPGKAGPVGPPGLGFPGLPGERGHPGVPGRPGVRGPDGLKGQ
KGDTISCNVTYPGRQGPPGFDGPPGPKGFPGPQGAPGLSGSDGHKGRPGTPGTSEIPGPP
GFRGDMGDPGFGGEKGSSPVGPPGPPGSPGVNGQKGIPGDPAFGHLGSPGRRGLSGVPGI
KGPRGDPGCPGAEGPAGIPGFPGLKGPKGREGHAGFPGVPGPPGHSCERGAPGIPGQPGL
PGYPGSPGAPGGKGQPGDVGPPGPAGMKGLPGLPGRPGAHGPPGLPGIPGPFGDDGLPGP
PGPKGPQGLPGFPGFPGERGKPGAEGCPGTKGEPGEKGMSGFPGDRGLRGAKGAIGPPGD
EGEMAIISQKGTPGEPGPPGVDGFPGERGDKGTPGMQGRRGEPGRYGPPGFHRGQPGEKG
QPGPPGPPGPPGSMGLRGFIGFPGLPGDQGEPGSPGPPGFSGIDGARGPKGNKGDPASHF
GPPGRKGEPGSPGCPGHFGASGEQGLPGIQGPRGSPGRPGPPGSSGPPGCPGDQGMPGLR
GQPGEMGDPGPRGLQGDPGIPGPPGIKGPSGSPGLNGLHGLKGQKGTKGASGLHDVGPPG
PVGIPGLKGERGDPGSPGISPPGPYGEKGPPGPPGRSGPPGPAGATGRAPKDIPDPGPPG
DQGPPGPDGPRGAPGPPGLPGSVDLLRGEPGDCGLPGPPGPPGPPGPPGYKGFPGCDGKD
GQKGPMGFPGPQGPHGFPGPPGEKGLPGPPGRKGPTGLPEISGEPGPPADVDDCPRIPGL
PGAPGMRGPEGAMGLPGMRGPPGPGCKGEPGLDGRRGVDGVPGSPGPPGRKGDTGEDGYP
GGPGPPGPTGDPGPKGFGPGYLGGFLLVLHSQTDQEPTCPLGMPRLWTGYSLLYLEGQEK
AHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMMPLSEEAIRP
YVSRCVVCESPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGS
CLEDFRAAPLLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKIS
RCQVCVKYS
Download sequence
Identical sequences H2P8S8
ENSPPYP00000014791 ENSPPYP00000014791 9600.ENSPPYP00000014791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]