SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014793 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014793
Domain Number 1 Region: 1542-1654
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-45
Family Noncollagenous (NC1) domain of collagen IV 0.00000408
Further Details:      
 
Domain Number 2 Region: 1430-1539
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014793   Gene: ENSPPYG00000013237   Transcript: ENSPPYT00000015390
Sequence length 1656
Comment pep:known_by_projection chromosome:PPYG2:2b:119281259:119437498:1 gene:ENSPPYG00000013237 transcript:ENSPPYT00000015390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSP
GQKGFTGPEGGFPGLPGLTGSKGVRGITGLPGFSGSPGLPGTPGNTGPYGLVGVPGCNGS
KGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKGEDIELDAKGDPGLPGAPGPQGLPGPP
GFPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGPPGTVIVTL
TGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGPQGKPGKDGVPGFP
GSEGVKGNRGFPGITGEDGIKGQKGDIGLPGFRGPTEYYDTHQEKGDEGTPGPPGPRGAR
GPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGLPGKDAMGTPGSPGCPGSPGL
PGSPGPPGPPGGIVFRKGPPGDRGLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGL
PGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEG
QVGAPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPG
PTGPAGPPGYGPQGEPGPQGTQGAPGDPGPPGEAGPRGELSVSTPVPGLPGPPGPPGHPG
PQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGE
PGLPGKPGLPGTKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLD
GPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRIGKTGSKGDPGIPGLDR
SGFPGETGSPGMPGHQGEMGPPGQKGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGN
PGMPGQRGSPGIPGVKGHRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLKGFTGNPGE
KGNRGIPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGELGLRGIPGSMGNRGMPGSKGK
RGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTPGPPGPTGDPGLPGDMGKKGEMGQPG
PPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGFLGPPGIRGPPPGSPGPMGIR
GAQGRDGIPGPAGEKGETGLLGAPPGPRGNPGAQGAKGDRGAPGFPGLPGRKGVMGDAGP
RGPTGIEGFPGPPGLPGAMIPGQKGNHGPPGSRGSPGEPGPPGPPGSHVIGIKGDKGSMG
HPGPKGPPGTVGDMGPPGHLGAPGTPGLPGLRGDPGFQGFPGVTGEKGNPGFLGSIGPPG
PIGPKGPPGIRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPG
KDGKPGTPGPAGEKGNKGSKGEPGPPGSDGLPGLKGKRGDSGSPATWTTRGFVFTRHSQT
TAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFA
SRNDYSYWLSTPALMPMDMAPITGRALEPYISRCTVCEGPAIAIAVHSQSTDIPPCPHGW
ISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLA
SLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH
Download sequence
Identical sequences H2P8T0
ENSPPYP00000014793 9600.ENSPPYP00000014793 ENSPPYP00000014793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]