SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014869 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014869
Domain Number 1 Region: 39-133
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.00000000000000357
Family Cathelicidin motif 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014869   Gene: ENSPPYG00000013298   Transcript: ENSPPYT00000015466
Sequence length 208
Comment pep:known_by_projection chromosome:PPYG2:2b:126515031:126541155:1 gene:ENSPPYG00000013298 transcript:ENSPPYT00000015466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISRMEKMTTMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVVKVNSQSLSPYL
FRAFRSSLKRVDVLDENTVMLEFSIRETTCRDSGEDPATCAFQRDYYVPTAVCRSTVKVS
AQQVQGVHARCSWSSSTSESYSSEEMIFGDMLGSHKWRHNYLFGLIPDESISEQFYDRSL
EIMRRVLPPGNRRYPNHRHRARINTDFE
Download sequence
Identical sequences H2P902
ENSPPYP00000014869 ENSPPYP00000014869 9600.ENSPPYP00000014869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]