SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014901 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014901
Domain Number 1 Region: 334-432
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.79e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000014901
Domain Number - Region: 185-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0464
Family Heme-binding PAS domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014901   Gene: ENSPPYG00000013324   Transcript: ENSPPYT00000015498
Sequence length 1226
Comment pep:known_by_projection chromosome:PPYG2:2b:130831641:130878271:-1 gene:ENSPPYG00000013324 transcript:ENSPPYT00000015498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYTEFPPSPSNPTEEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDARQSPDAFSLMMAKSEHNPSTSGCSSNQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSEGHPCGADVPSYTVEEMES
ITSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFH
SFTSPYKLPLWSVCSGADSFTQECMEEKSFFCRVSVGKSHENEIRYHPFRMTPYLVKVRD
QQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQD
LIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINP
WSRKISFIIGRHKVRVGPLNEDVFAAHPCIEKALHPSIQELTEQIHRLLLQPVPHSGSSG
YGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSV
TEMQTNPPAEKKAVPAMEKDSLGVSFPEELACKDQPTCSYQQISCLDSVIRYLESCNEAA
TLKRKCEFPANVPALRSSDKRKATVSPGPHAGEAEPPSRVNSRTGVGTHLTSLALPGKAE
SVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAASGPESLDCLVGPALACGLSQEKEPFK
KLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRNT
SGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNTTAWSPSDTSQSSC
PAVPFPAPVPAAYSLPMFPAPGTVVAPPAPPHASFAVPAVPVDLQHQFAVQPPPFPAPLP
VMAFMLPSYSFPSGTPNMASASQEFTSRSIPRQSCAPTRATPPSAMGRSPPLFQSRSSSP
QLNLLQLEEAPEGGTGAMGTTGATETAAVGADCKPGTSRDQQLKAPLTRDEPSDTQNSDA
LSTSSGLLNLLLNEDLCSASGSAASESLGSGSLGCDASPSGAGSSDTSHTSKYFGSIDSS
ENNHKAKMNTGMEESERFIKCVLQDPIWLLMADADSSVMMTYQLPSRNLEAVLKEDREKL
KLLQKLQPRFTESQKQEMREVHQWMQTGSLPAAIDVAECVYCENKEKGNICLPYEEDIPS
LGLSEVSDTKEDENGSPLNHRIEEQT
Download sequence
Identical sequences H2P933
ENSPPYP00000014901 9600.ENSPPYP00000014901 ENSPPYP00000014901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]