SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015046 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015046
Domain Number 1 Region: 345-668
Classification Level Classification E-value
Superfamily Urocanase 8.89e-111
Family Urocanase 0.00000405
Further Details:      
 
Domain Number 2 Region: 96-285
Classification Level Classification E-value
Superfamily Urocanase 6.8e-72
Family Urocanase 0.0000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015046   Gene: ENSPPYG00000013452   Transcript: ENSPPYT00000015647
Sequence length 693
Comment pep:known_by_projection chromosome:PPYG2:3:6279219:6316740:1 gene:ENSPPYG00000013452 transcript:ENSPPYT00000015647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCWPLPPSQSHMSSLQALCSGLPLRPLPENRGRQAGVPHAPVRTPSLSPAEKQLALRNAL
RYFPPDVQELLAPEFAQELQLYGHIYMYRFCPDIEMRAYSIEQYPCQTKAAAAIMHMIMN
NLDPAVAQFPQELVTYGGNGQVFSNWAQFWLTMFYLSKMTEEQTLVMYSGHPLGLFPSSR
SAPRLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIIHGTVLTVLNA
ARRYLGIEDLAGKVFVDKAALEKRYKQGWLMEVTDSLDRCIQRLRVLQLGLQQALGWAGL
PAALGLCVLSCFVNLAPLGEGTCLAPSGFSRPLLGAPILLLCPSREARKKKEVLSLGYHG
NVVTLWERLVHKLDTTGECLVNLGSDQTSCHNPFNGRYYPVQLNFTEPKLMASNPAVFKL
VQELRRQVSAINRLAEEKFFFWDYGNAFLLEAQRAGADVEKKGAGRTEFRYPSYVQHIMG
DIFSQGFGPFRWVCTSGDPQDLAVTDELATSVLEEAIADGVVGSQARILYSDQKGRVAIA
VAINQAIACRRIKAPVVLSRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDACRG
ATWVALHNGGGVGWGEVINGGFGLVLDGTPEAERRARLMLSWDVSNGVARRCWSGNQKAY
EIICQTMQENSSLVVTLPHKVEDERVLQQALQL
Download sequence
Identical sequences H2P9G9
ENSPPYP00000015046 9600.ENSPPYP00000015046 ENSPPYP00000015046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]