SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015052 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015052
Domain Number 1 Region: 456-929
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-161
Family ALDH-like 0.000000001
Further Details:      
 
Domain Number 2 Region: 44-244
Classification Level Classification E-value
Superfamily Formyltransferase 1.06e-50
Family Formyltransferase 0.0000000024
Further Details:      
 
Domain Number 3 Region: 249-349
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.88e-24
Family Post formyltransferase domain 0.00000129
Further Details:      
 
Domain Number 4 Region: 368-444
Classification Level Classification E-value
Superfamily ACP-like 0.00000792
Family Acyl-carrier protein (ACP) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015052   Gene: ENSPPYG00000013456   Transcript: ENSPPYT00000015653
Sequence length 931
Comment pep:known chromosome:PPYG2:3:6607868:6685851:1 gene:ENSPPYG00000013456 transcript:ENSPPYT00000015653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHLLAPRTGLHQPQFRGCGSQKSSLPGTPAPIPARGPSNPPAAMKIAVIGQSLFGQEVYC
HLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKFSRWRAKGQALPDVVAKYQALG
AELNVLPFCSQFIPMEIINAPQHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFSIFWA
DDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEG
ATYEGDSEERDGQINWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPE
GDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSALELT
EAELVTAEAVRSVWQRILPNVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENED
VYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTIRIPHQLFIGGEFVDAEGAK
TYETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISARDRGRLLYRLADLME
QHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGSTIPINQARPNRNLT
LTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAG
IPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKSCAISNVKKVSLELGGK
SPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMKVG
DPLDRDTDHGPQNHHAHLMKLMEYCQRGVKEGATLVCGGNQVPRPGFFFEPTVFTDVEDH
MFIAKEESFGPVMIISRFADGDVDTVLSRANATEFGLASGVFTRDINKALYVSDKLQAGT
VFVNTYNKTDVAAPFGGFKQSGFGKDLGEEA
Download sequence
Identical sequences H2P9H5
ENSPPYP00000015052 ENSPPYP00000015052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]